ARF5, Mouse, Clone: 1B6, Abnova™

Catalog No.	Quantity
89-016-196	100 μg

Catalog No. 89-016-196 Supplier Abnova Corporation Supplier No. H00000381M02

Description

Mouse monoclonal antibody raised against a partial recombinant ARF5.

ADP-ribosylation factor 5 (ARF5) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. The ARF5 gene spans approximately 3.2kb of genomic DNA and contains six exons and five introns. [provided by RefSeq

Sequence: YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Specifications

• Antigen: ARF5
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ARF5.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ARF5
• Gene Accession No.: BC003043
• Gene Symbols: ARF5
• Host Species: Mouse
• Immunogen: ARF5 (AAH03043, 81 a.a. ∼ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 381
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ