ADP-ribosylation factor 6, Mouse, Clone: 2A4, Abnova™

Catalog No.	Quantity
89-001-427	200 μL

Catalog No. 89-001-427 Supplier Abnova Corporation Supplier No. H00000382M01A

Description

Mouse monoclonal antibody raised against a full-length recombinant ARF6.

This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. [provided by RefSeq

Sequence: MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

Specifications

• Antigen: ADP-ribosylation factor 6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ARF6.
• Formulation: ascites with no preservative
• Gene: ARF6
• Gene Accession No.: BC008918
• Gene Alias: DKFZp564M0264
• Gene Symbols: ARF6
• Host Species: Mouse
• Immunogen: ARF6 (AAH08918, 1 a.a. ∼ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 382
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ