Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ADP-ribosylation factor related protein 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004472 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-472 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-472 Supplier Abnova Corporation Supplier No. H00010139A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant ARFRP1.

The protein encoded by this gene is a membrane-associated GTP-ase and localizes to the plasma membrane. It is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) genes. The gene is located in a gene cluster that includes the a gene (M68) that is overexpressed in some tumors. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: ANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT

Specifications

Antigen ADP-ribosylation factor related protein 1
Applications ELISA
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant ARFRP1.
Formulation 50% glycerol
Gene ARFRP1
Gene Accession No. NM_003224
Gene Alias ARL18/ARP/Arp1
Gene Symbols ARFRP1
Host Species Mouse
Immunogen ARFRP1 (NP_003215, 133 a.a. ∼ 201 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10139
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.