Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004020

Rho GTPase activating protein 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004020 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-020 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-020 Supplier Abnova Corporation Supplier No. H00000392A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant ARHGAP1.

Sequence: GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL

Specifications

Antigen Rho GTPase activating protein 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant ARHGAP1.
Formulation 50% glycerol
Gene ARHGAP1
Gene Accession No. BC018118
Gene Alias CDC42GAP/RHOGAP/RHOGAP1/p50rhoGAP
Gene Symbols ARHGAP1
Host Species Mouse
Immunogen ARHGAP1 (AAH18118, 340 a.a. ∼ 439 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 392
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.