ARHGAP4, Mouse, Clone: 3F7, Abnova™

Catalog No.	Quantity
89-016-207	100 μg

Catalog No. 89-016-207 Supplier Abnova Corporation Supplier No. H00000393M01

Description

Mouse monoclonal antibody raised against a partial recombinant ARHGAP4.

This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH

Specifications

• Antigen: ARHGAP4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3F7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ARHGAP4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ARHGAP4
• Gene Accession No.: BC052303
• Gene Alias: C1/KIAA0131/RGC1/RhoGAP4/p115
• Gene Symbols: ARHGAP4
• Host Species: Mouse
• Immunogen: ARHGAP4 (AAH52303, 881 a.a. ∼ 986 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 393
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ