Rho GDP dissociation inhibitor (GDI) alpha (A02), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant ARHGDIA.

Supplier:  Abnova Corporation H00000396A02

Catalog No. 89-004-021

Description

Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM

Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD

Specifications

• Antigen: Rho GDP dissociation inhibitor (GDI) alpha
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length recombinant ARHGDIA.
• Gene: ARHGDIA
• Gene Alias: GDIA1/MGC117248/RHOGDI/RHOGDI-1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC005851
• Gene Symbols: ARHGDIA
• Immunogen: ARHGDIA (AAH05851, 1 a.a. ∼ 204 a.a) full-length recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 396
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.