Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Rho GDP dissociation inhibitor (GDI) alpha, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein.

Manufacturer:  Abnova Corporation H00000396D03P

Catalog No. 89-018-018


  Check Availability
Add to cart

Specifications

Description

Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM

Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Description & Specifications

Specifications

Rho GDP dissociation inhibitor (GDI) alpha
Unlabeled
Rho GDP dissociation inhibitor (GDI) alpha
In 1X PBS, pH 7.4
BC016031
ARHGDIA
ARHGDIA (AAH16031.1, 1 a.a. ∽204 a.a) full-length human protein.
100μg
Signal Transduction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
Human
Affinity Purified
ARHGDIA
GDIA1, MGC117248, RHOGDI, RHOGDI-1
Rabbit
Protein A column
RUO
Human
Primary
396
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit