Rho GDP dissociation inhibitor (GDI) alpha, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein.

Manufacturer: Abnova Corporation H00000396D03P

Catalog No. 89-018-018

  Check Availability
Add to Cart

    Specifications

    Antigen Rho GDP dissociation inhibitor (GDI) alpha
    Applications Western Blotting
    Conjugate Unlabeled
    Cross Reactivity Human
    Description Rho GDP dissociation inhibitor (GDI) alpha
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene ARHGDIA
    Gene Accession No. BC016031
    Gene Alias GDIA1, MGC117248, RHOGDI, RHOGDI-1
    Gene Symbols ARHGDIA
    Host Species Rabbit
    Immunogen ARHGDIA (AAH16031.1, 1 a.a. ∽204 a.a) full-length human protein.
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Research Discipline Signal Transduction
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Polyclonal
    Gene ID (Entrez) 396

    Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM

    Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit