Rho guanine nucleotide exchange factor (GEF) 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ARHGEF3.

Supplier:  Abnova Corporation H00050650A01

Catalog No. 89-004-615

Description

Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLK

Specifications

• Antigen: Rho guanine nucleotide exchange factor (GEF) 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ARHGEF3.
• Gene: ARHGEF3
• Gene Alias: DKFZp434F2429/FLJ98126/GEF3/MGC118905/STA3/XPLN
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_019555
• Gene Symbols: ARHGEF3
• Immunogen: ARHGEF3 (NP_062455, 33 a.a. ∼ 142 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 50650
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.