ADP-ribosylation factor-like 4D, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human ARL4D protein.

Supplier:  Abnova Corporation H00000379B01

Catalog No. 89-004-925

Description

ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq

Sequence: MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR

Specifications

• Antigen: ADP-ribosylation factor-like 4D
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human ARL4D protein.
• Gene: ARL4D
• Gene Alias: ARF4L/ARL6
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: NM_001661
• Gene Symbols: ARL4D
• Immunogen: ARL4D (NP_001652, 1 a.a. ∼ 201 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 379
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.