ARNT (M02), Mouse anti-Human, Clone: 1F12, Abnova™

Catalog No.	Quantity
89-123-138	50 μg

Catalog No. 89-123-138 Supplier Abnova Corporation Supplier No. H00000405M02

Description

Mouse monoclonal antibody raised against a partial recombinant ARNT.

The aryl hydrocarbon (Ah) receptor is involved in the induction of several enzymes that participate in xenobiotic metabolism. The ligand-free, cytosolic form of the Ah receptor is complexed to heat shock protein 90. Binding of ligand, which includes dioxin and polycyclic aromatic hydrocarbons, results in translocation of the ligand-binding subunit only to the nucleus. Induction of enzymes involved in xenobiotic metabolism occurs through binding of the ligand-bound Ah receptor to xenobiotic responsive elements in the promoters of genes for these enzymes. This gene encodes a protein that forms a complex with the ligand-bound Ah receptor, and is required for receptor function. The encoded protein has also been identified as the beta subunit of a heterodimeric transcription factor, hypoxia-inducible factor 1 (HIF1). A t(1;12)(q21;p13) translocation, which results in a TEL-ARNT fusion protein, is associated with acute myeloblastic leukemia. Three alternatively spliced variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT

Specifications

• Antigen: ARNT
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ARNT.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ARNT
• Gene Accession No.: BC060838
• Gene Alias: HIF-1beta/HIF1B/HIF1BETA/TANGO/bHLHe2
• Gene Symbols: ARNT
• Host Species: Mouse
• Immunogen: ARNT (AAH60838, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 405
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ