arrestin, beta 2, Mouse, Clone: 4D2, Abnova™

Catalog No.	Quantity
89-000-530	100 μg

Catalog No. 89-000-530 Supplier Abnova Corporation Supplier No. H00000409M06

Description

Mouse monoclonal antibody raised against a partial recombinant ARRB2.

Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq

Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC

Specifications

• Antigen: arrestin, beta 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 4D2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ARRB2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ARRB2
• Gene Accession No.: BC007427
• Gene Alias: ARB2/ARR2/BARR2/DKFZp686L0365
• Gene Symbols: ARRB2
• Host Species: Mouse
• Immunogen: ARRB2 (AAH07427, 300 a.a. ∼ 409 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 409
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ