ADP-ribosyltransferase 3, Mouse, Clone: 3A2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ART3.

Supplier:  Abnova Corporation H00000419M05

Catalog No. 89-014-054

Description

ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases, such as ART3, transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases (see PARG; MIM 603501) reverse the reaction (Glowacki et al., 2002 [PubMed 12070318]).[supplied by OMIM

Sequence: LDMADNAFDDEYLKCTDRMEIKYVPQLLKEEKASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVKMAGQSREDYIYGFQFKAF

Specifications

• Antigen: ADP-ribosyltransferase 3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001179
• Gene Symbols: ART3
• Immunogen: ART3 (NP_001170, 29 a.a. ∼ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 3A2
• Description: Mouse monoclonal antibody raised against a partial recombinant ART3.
• Gene: ART3
• Gene Alias: FLJ26404
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 419
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ