ARVCF, Mouse, Clone: 5D2, Abnova™

Catalog No.	Quantity
89-016-219	100 μg

Catalog No. 89-016-219 Supplier Abnova Corporation Supplier No. H00000421M01

Description

Mouse monoclonal antibody raised against a partial recombinant ARVCF.

Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family which play an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS) a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein. [provided by RefSeq

Sequence: LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSAGEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV

Specifications

• Antigen: ARVCF
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 5D2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ARVCF.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ARVCF
• Gene Accession No.: NM_001670
• Gene Alias: FLJ35345
• Gene Symbols: ARVCF
• Host Species: Mouse
• Immunogen: ARVCF (NP_001661, 863 a.a. ∼ 962 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 421
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ