aristaless related homeobox, Mouse, Clone: 4A8, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant ARX.

Supplier:  Abnova Corporation H00170302M08

Catalog No. 89-001-404

Description

This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq

Sequence: LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR

Specifications

• Antigen: aristaless related homeobox
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_139058
• Gene Symbols: ARX
• Immunogen: ARX (NP_620689, 159 a.a. ∼ 264 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4A8
• Description: Mouse monoclonal antibody raised against a full-length recombinant ARX.
• Gene: ARX
• Gene Alias: ISSX/MRX29/MRX32/MRX33/MRX36/MRX38/MRX43/MRX54/MRX76/MRX87/MRXS1/PRTS
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 170302
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ