ASAH1, Mouse, Clone: 1A7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ASAH1.

Supplier:  Abnova Corporation H00000427M02

Catalog No. 89-016-221

Description

This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD

Specifications

• Antigen: ASAH1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_177924
• Gene Symbols: ASAH1
• Immunogen: ASAH1 (NP_808592, 25 a.a. ∼ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG3 κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1A7
• Description: Mouse monoclonal antibody raised against a partial recombinant ASAH1.
• Gene: ASAH1
• Gene Alias: AC/ASAH/FLJ21558/FLJ22079/PHP/PHP32
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 427
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid