ASAH1, Mouse, Clone: 2C9, Abnova™

Catalog No.	Quantity
89-016-220	100 μg

Catalog No. 89-016-220 Supplier Abnova Corporation Supplier No. H00000427M01

Description

Mouse monoclonal antibody raised against a partial recombinant ASAH1.

This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into sphingosine and fatty acid. Mutations in this gene have been associated with a lysosomal storage disorder known as Farber disease. Multiple transcript variants encoding several distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: PPWTEDCRKSTYPPSGPTYRGAVPWYTINLDLPPYKRWHELMLDKAPMLKVIVNSLKNMINTFVPSGKVMQVVDEKLPGLLGNFPGPFEEEMKGIAAVTD

Specifications

• Antigen: ASAH1
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ASAH1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ASAH1
• Gene Accession No.: NM_177924
• Gene Alias: AC/ASAH/FLJ21558/FLJ22079/PHP/PHP32
• Gene Symbols: ASAH1
• Host Species: Mouse
• Immunogen: ASAH1 (NP_808592, 25 a.a. ∼ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 427
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG3 κ