ankyrin repeat and SOCS box-containing 11, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ASB11.

Supplier:  Abnova Corporation H00140456A01

Catalog No. 89-004-792

Description

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: KLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ

Specifications

• Antigen: ankyrin repeat and SOCS box-containing 11
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ASB11.
• Gene: ASB11
• Gene Alias: DKFZp779E2460/MGC119168/MGC119169
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_080873
• Gene Symbols: ASB11
• Immunogen: ASB11 (NP_543149, 214 a.a. ∼ 323 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 140456
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.