Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004792

ankyrin repeat and SOCS box-containing 11, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004792 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-792 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-792 Supplier Abnova Corporation Supplier No. H00140456A01
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant ASB11.

The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: KLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ

Specifications

Antigen ankyrin repeat and SOCS box-containing 11
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant ASB11.
Formulation 50% glycerol
Gene ASB11
Gene Accession No. NM_080873
Gene Alias DKFZp779E2460/MGC119168/MGC119169
Gene Symbols ASB11
Host Species Mouse
Immunogen ASB11 (NP_543149, 214 a.a. ∼ 323 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 140456
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.