achaete-scute complex homolog 1 (Drosophila), Mouse, Clone: 3D3, Abnova™

Catalog No.	Quantity
89-000-531	100 μg

Catalog No. 89-000-531 Supplier Abnova Corporation Supplier No. H00000429M03

Description

Mouse monoclonal antibody raised against a partial recombinant ASCL1.

This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq]

Sequence: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF

Specifications

• Antigen: achaete-scute complex homolog 1 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ASCL1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ASCL1
• Gene Accession No.: NM_004316
• Gene Alias: ASH1/HASH1/MASH1/bHLHa46
• Gene Symbols: ASCL1
• Host Species: Mouse
• Immunogen: ASCL1 (NP_004307, 137 a.a. ∼ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Neurobiology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 429
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ