ASCL1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-224	50 μL

Catalog No. 89-003-224 Supplier Abnova Corporation Supplier No. H00000429A01

Description

Mouse polyclonal antibody raised against a partial recombinant ASCL1.

This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq]

Sequence: GFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF

Specifications

• Antigen: ASCL1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ASCL1.
• Formulation: 50% glycerol
• Gene: ASCL1
• Gene Accession No.: NM_004316
• Gene Alias: ASH1/HASH1/MASH1/bHLHa46
• Gene Symbols: ASCL1
• Host Species: Mouse
• Immunogen: ASCL1 (NP_004307, 137 a.a. ∼ 236 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 429
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid