Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014056

asparagine synthetase, Mouse, Clone: 3B3, Abnova™

Catalog No. 89014056 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-056 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-056 Supplier Abnova Corporation Supplier No. H00000440M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant ASNS.

The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. There are three alternatively spliced transcript variants encoding the same protein described for this gene. [provided by RefSeq

Sequence: YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKA

Specifications

Antigen asparagine synthetase
Applications ELISA
Classification Monoclonal
Clone 3B3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ASNS.
Formulation PBS with no preservative; pH 7.4
Gene ASNS
Gene Accession No. BC014621
Gene Alias TS11
Gene Symbols ASNS
Host Species Mouse
Immunogen ASNS (AAH14621, 281 a.a. ∼ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 440
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.