aspartoacylase (Canavan disease), Mouse, Clone: 3C11, Abnova™

Catalog No.	Quantity
89-014-057	100 μg

Catalog No. 89-014-057 Supplier Abnova Corporation Supplier No. H00000443M09

Description

Mouse monoclonal antibody raised against a partial recombinant ASPA.

This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq

Sequence: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLF

Specifications

• Antigen: aspartoacylase (Canavan disease)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ASPA.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ASPA
• Gene Accession No.: NM_000049
• Gene Alias: ACY2/ASP
• Gene Symbols: ASPA
• Host Species: Mouse
• Immunogen: ASPA (NP_000040, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 443
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ