activating transcription factor 2, Mouse, Clone: 3A3, Abnova™

Catalog No.	Quantity
89-000-587	100 μg

Catalog No. 89-000-587 Supplier Abnova Corporation Supplier No. H00001386M09

Description

Mouse monoclonal antibody raised against a full-length recombinant ATF2.

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. The protein forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. The protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. Additional transcript variants have been identified but their biological validity has not been determined. [provided by RefSeq

Sequence: PFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVP*

Specifications

• Antigen: activating transcription factor 2
• Applications: ELISA, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 3A3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ATF2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATF2
• Gene Accession No.: NM_001880
• Gene Alias: CRE-BP1/CREB2/HB16/MGC111558/TREB7
• Gene Symbols: ATF2
• Host Species: Mouse
• Immunogen: ATF2 (NP_001871, 91 a.a. ∼ 190 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1386
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ