activating transcription factor 3, Mouse, Clone: 8G5, Abnova™

Catalog No.	Quantity
89-000-532	100 μg

Catalog No. 89-000-532 Supplier Abnova Corporation Supplier No. H00000467M04

Description

Mouse monoclonal antibody raised against a full-length recombinant ATF3.

Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. [provided by RefSeq

Sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Specifications

• Antigen: activating transcription factor 3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 8G5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant ATF3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATF3
• Gene Accession No.: BC006322
• Gene Symbols: ATF3
• Host Species: Mouse
• Immunogen: ATF3 (AAH06322, 1 a.a. ∼ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 467
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ