Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATOH1, Mouse, Clone: 1F3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATOH1.

Manufacturer:  Abnova Corporation H00000474M03A

Catalog No. 89-016-240


  Check Availability
Add to cart

Specifications

Description

This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq

Sequence: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Description & Specifications

Specifications

ATOH1
1F3
atonal homolog 1 (Drosophila)
ATOH1
Ascites
ATOH1
ATOH1 (NP_005163, 266 a.a. ∽355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
200μL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
In ascites fluid
NM_005172
ATH1, HATH1, MATH-1, bHLHa14
Murine
IgG2a, κ
RUO
Primary
474
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit