atonal homolog 1 (Drosophila), Mouse, Clone: 1F3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATOH1.

Manufacturer: Abnova Corporation H00000474M03

Catalog No. 89-000-533

  Check Availability
Add to Cart

    Specifications

    Antigen atonal homolog 1 (Drosophila)
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 1F3
    Conjugate Unlabeled
    Cross Reactivity Human
    Description atonal homolog 1 (Drosophila)
    Format Affinity Purified
    Formulation In 1X PBS, pH 7.4
    Gene ATOH1
    Gene Accession No. NM_005172
    Gene Alias ATH1, HATH1, MATH-1, bHLHa14
    Gene Symbols ATOH1
    Host Species Mouse
    Immunogen ATOH1 (NP_005163, 266 a.a. ∽355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
    Isotype IgG2a
    Purification Method Protein A column
    Quantity 100μg
    Regulatory Status RUO
    Research Discipline Transcription Regulation
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Whole Molecule Y
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 474

    This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. [provided by RefSeq

    Sequence: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit