Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATOX1 (M09), Mouse anti-Human, Clone: 3A1, Abnova™

Catalog No. 89016257 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-016-257 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-016-257 Supplier Abnova Corporation Supplier No. H00000475M09
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ATOX1.

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Specifications

Antigen ATOX1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3A1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Formulation PBS with no preservative; pH 7.4
Gene ATOX1
Gene Accession No. NM_004045
Gene Alias ATX1/HAH1/MGC138453/MGC138455
Gene Symbols ATOX1
Host Species Mouse
Immunogen ATOX1 (NP_004036, 1 a.a. ∼ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 475
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.