Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATOX1, Mouse, Clone: 3D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATOX1.

Manufacturer:  Abnova Corporation H00000475M03

Catalog No. 89-016-251


  Check Availability
Add to cart

Specifications

Description

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq

Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Description & Specifications

Specifications

ATOX1
3D10
Human
Liquid
ATOX1
ATX1, HAH1, MGC138453, MGC138455
Murine
IgG2a, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
ATX1 antioxidant protein 1 homolog (yeast)
In 1X PBS, pH 7.4
NM_004045
ATOX1
ATOX1 (NP_004036, 1 a.a. ∽69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
50μg
Human
Primary
475
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit