ATOX1, Mouse, Clone: 3D10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant ATOX1.

Manufacturer: Abnova Corporation H00000475M03

Catalog No. 89-016-251

  Check Availability
Add to Cart

    Specifications

    Antigen ATOX1
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 3D10
    Conjugate Unlabeled
    Cross Reactivity Human
    Description ATX1 antioxidant protein 1 homolog (yeast)
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene ATOX1
    Gene Accession No. NM_004045
    Gene Alias ATX1, HAH1, MGC138453, MGC138455
    Gene Symbols ATOX1
    Host Species Mouse
    Immunogen ATOX1 (NP_004036, 1 a.a. ∽69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG2a, κ
    Quantity 50μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 475

    This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq

    Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit