ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, Mouse, Clone: 6F8, Abnova™

Catalog No.	Quantity
89-000-536	100 μg

Catalog No. 89-000-536 Supplier Abnova Corporation Supplier No. H00000487M02

Description

Mouse monoclonal antibody raised against a partial recombinant ATP2A1.

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ

Specifications

• Antigen: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6F8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATP2A1
• Gene Accession No.: NM_173201
• Gene Alias: ATP2A/SERCA1
• Gene Symbols: ATP2A1
• Host Species: Mouse
• Immunogen: ATP2A1 (NP_775293, 522 a.a. ∼ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 487
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ