ATP2A3, Mouse, Clone: 1B9, Abnova™

Catalog No.	Quantity
89-123-140	100 μg

Catalog No. 89-123-140 Supplier Abnova Corporation Supplier No. H00000489M02

Description

Mouse monoclonal antibody raised against a partial recombinant ATP2A3.

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Sequence: TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR

Specifications

• Antigen: ATP2A3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP2A3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATP2A3
• Gene Accession No.: BC035729
• Gene Alias: SERCA3
• Gene Symbols: ATP2A3
• Host Species: Mouse
• Immunogen: ATP2A3 (AAH35729, 501 a.a. ∼ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 489
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ