Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ATPase, Ca++ transporting, type 2C, member 1, Mouse, Clone: 2G1, Abnova™

Catalog No. 89014296 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-296 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-296 Supplier Abnova Corporation Supplier No. H00027032M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant ATP2C1.

The protein encoded by this gene belongs to the family of P-type cation transport ATPases. This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Defects in this gene cause Hailey-Hailey disease, an autosomal dominant disorder. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL

Specifications

Antigen ATPase, Ca++ transporting, type 2C, member 1
Applications ELISA, Immunofluorescence, Immunoprecipitation, KnockDown, Western Blot
Classification Monoclonal
Clone 2G1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant ATP2C1.
Formulation PBS with no preservative; pH 7.4
Gene ATP2C1
Gene Accession No. BC028139
Gene Alias ATP2C1A/BCPM/HHD/KIAA1347/PMR1/SPCA1/hSPCA1
Gene Symbols ATP2C1
Host Species Mouse
Immunogen ATP2C1 (AAH28139, 119 a.a. ∼ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27032
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.