ATP4B, Mouse, Clone: 1D10, Abnova™

Catalog No.	Quantity
89-016-273	100 μg

Catalog No. 89-016-273 Supplier Abnova Corporation Supplier No. H00000496M10

Description

Mouse monoclonal antibody raised against a partial recombinant ATP4B.

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq]

Sequence: DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGK

Specifications

• Antigen: ATP4B
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant ATP4B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATP4B
• Gene Accession No.: NM_000705
• Gene Alias: ATP6B
• Gene Symbols: ATP4B
• Host Species: Mouse
• Immunogen: ATP4B (NP_000696.1, 67 a.a. ∼ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 496
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ