ATPase, H+/K+ exchanging, beta polypeptide, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-954	50 μL

Catalog No. 89-004-954 Supplier Abnova Corporation Supplier No. H00000496B02

Description

Mouse polyclonal antibody raised against a full-length human ATP4B protein.

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq]

Sequence: MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

Specifications

• Antigen: ATPase, H+/K+ exchanging, beta polypeptide
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human ATP4B protein.
• Formulation: No additive
• Gene: ATP4B
• Gene Accession No.: NM_000705.2
• Gene Alias: ATP6B
• Gene Symbols: ATP4B
• Host Species: Mouse
• Immunogen: ATP4B (NP_000696.1, 1 a.a. ∼ 291 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 496
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum