ATP5E, Mouse, Clone: 1A8, Abnova™

Catalog No.	Quantity
89-123-141	100 μg

Catalog No. 89-123-141 Supplier Abnova Corporation Supplier No. H00000514M02

Description

Mouse monoclonal antibody raised against a full-length recombinant ATP5E.

This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. [provided by RefSeq

Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE

Specifications

• Antigen: ATP5E
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant ATP5E.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATP5E
• Gene Accession No.: BC001690
• Gene Alias: ATPE/MGC104243
• Gene Symbols: ATP5E
• Host Species: Mouse
• Immunogen: ATP5E (AAH01690, 1 a.a. ∼ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 514
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ