ATP5J, Mouse, Clone: 1F10, Abnova™

Catalog No.	Quantity
89-016-276	100 μg

Catalog No. 89-016-276 Supplier Abnova Corporation Supplier No. H00000522M01

Description

Mouse monoclonal antibody raised against a full-length recombinant ATP5J.

Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, F0, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The F0 seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the F6 subunit of the F0 complex, required for F1 and F0 interactions. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Specifications

• Antigen: ATP5J
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant ATP5J.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATP5J
• Gene Accession No.: BC001178
• Gene Alias: ATP5/ATP5A/ATPM/CF6/F6
• Gene Symbols: ATP5J
• Host Species: Mouse
• Immunogen: ATP5J (AAH01178, 1 a.a. ∼ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 522
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ