ATXN2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-072	50 μL

Catalog No. 89-003-072 Supplier Abnova Corporation Supplier No. H00006311A01

Description

Mouse polyclonal antibody raised against a partial recombinant ATXN2.

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. Defects in this gene are the cause of spinocerebellar ataxia type 2 (SCA2). SCA2 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. SCA2 is caused by expansion of a CAG repeat in the coding region of this gene. Longer expansions result in earlier onset of the disease. Alternatively spliced transcript variants encoding different isoforms have been identified but their full length sequence has not been determined. [provided by RefSeq

Sequence: PQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL

Specifications

• Antigen: ATXN2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ATXN2.
• Formulation: 50% glycerol
• Gene: ATXN2
• Gene Accession No.: NM_002973
• Gene Alias: ATX2/FLJ46772/SCA2/TNRC13
• Gene Symbols: ATXN2
• Host Species: Mouse
• Immunogen: ATXN2 (NP_002964, 1214 a.a. ∼ 1313 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6311
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid