AXL receptor tyrosine kinase, Mouse, Clone: 6G1, Abnova™

Catalog No.	Quantity
89-000-538	100 μg

Catalog No. 89-000-538 Supplier Abnova Corporation Supplier No. H00000558M02

Description

Mouse monoclonal antibody raised against a partial recombinant AXL.

The protein encoded by this gene is a member of the receptor tyrosine kinase subfamily. Although it is similar to other receptor tyrosine kinases, this protein represents a unique structure of the extracellular region that juxtaposes IgL and FNIII repeats. It transduces signals from the extracellular matrix into the cytoplasm by binding growth factors like vitamin K-dependent protein growth-arrest-specific gene 6. It is involved in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY

Specifications

• Antigen: AXL receptor tyrosine kinase
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6G1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant AXL.
• Formulation: PBS with no preservative; pH 7.4
• Gene: AXL
• Gene Accession No.: BC032229
• Gene Alias: JTK11/UFO
• Gene Symbols: AXL
• Host Species: Mouse
• Immunogen: AXL (AAH32229, 30 a.a. ∼ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 558
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ