UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant B3GNT3.

Supplier:  Abnova Corporation H00010331A01

Catalog No. 89-004-488

Description

This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq

Sequence: KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN

Specifications

• Antigen: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant B3GNT3.
• Gene: B3GNT3
• Gene Alias: B3GAL-T8/B3GN-T3/B3GNT-3/HP10328/TMEM3/beta3Gn-T3
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 10331
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_014256
• Gene Symbols: B3GNT3
• Immunogen: B3GNT3 (NP_055071, 135 a.a. ∼ 208 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum