UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5, Mouse, Clone: 5G9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant B4GALT5.

Supplier:  Abnova Corporation H00009334M06A

Catalog No. 89-001-509

Description

This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. [provided by RefSeq

Sequence: AQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGG

Specifications

• Antigen: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_004776
• Gene Symbols: B4GALT5
• Immunogen: B4GALT5 (NP_004767, 48 a.a. ∼ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG1 κ

• Applications: ELISA, Western Blot
• Clone: 5G9
• Description: Mouse monoclonal antibody raised against a partial recombinant B4GALT5.
• Gene: B4GALT5
• Gene Alias: B4Gal-T5/BETA4-GALT-IV/MGC138470/beta4Gal-T5/beta4GalT-V/gt-V
• Host Species: Mouse
• Quantity: 200 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 9334
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites