BACE2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-138	50 μL

Catalog No. 89-003-138 Supplier Abnova Corporation Supplier No. H00025825A01

Description

Mouse polyclonal antibody raised against a partial recombinant BACE2.

Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Sequence: TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYR

Specifications

• Antigen: BACE2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BACE2.
• Formulation: 50% glycerol
• Gene: BACE2
• Gene Accession No.: NM_012105
• Gene Alias: AEPLC/ALP56/ASP1/ASP21/BAE2/CDA13/CEAP1/DRAP
• Gene Symbols: BACE2
• Host Species: Mouse
• Immunogen: BACE2 (NP_036237, 306 a.a. ∼ 395 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 25825
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid