BACH1, Mouse, Clone: 1B8, Abnova™

Catalog No.	Quantity
89-016-290	100 μg

Catalog No. 89-016-290 Supplier Abnova Corporation Supplier No. H00000571M02

Description

Mouse monoclonal antibody raised against a partial recombinant BACH1.

This gene encodes a transcription factor that belongs to the cap'n'collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq]

Sequence: HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC

Specifications

• Antigen: BACH1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BACH1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BACH1
• Gene Accession No.: NM_206866
• Gene Symbols: BACH1
• Host Species: Mouse
• Immunogen: BACH1 (NP_996749, 396 a.a. ∼ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 571
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ