brain-specific angiogenesis inhibitor 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BAI2.

Supplier:  Abnova Corporation H00000576A01

Catalog No. 89-004-030

Description

BAI1, a p53-target gene, encodes brain-specific angiogenesis inhibitor, a seven-span transmembrane protein and is thought to be a member of the secretin receptor family. Brain-specific angiogenesis proteins BAI2 and BAI3 are similar to BAI1 in structure, have similar tissue specificities and may also play a role in angiogenesis. [provided by RefSeq

Sequence: DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ

Specifications

• Antigen: brain-specific angiogenesis inhibitor 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant BAI2.
• Gene: BAI2
• Gene Symbols: BAI2
• Immunogen: BAI2 (NP_001694, 22 a.a. ∼ 108 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 576
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001703
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Neurobiology
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum