BARD1, Mouse, Clone: 2A11, Abnova™

Catalog No.	Quantity
89-016-293	100 μg

Catalog No. 89-016-293 Supplier Abnova Corporation Supplier No. H00000580M01

Description

Mouse monoclonal antibody raised against a partial recombinant BARD1.

This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. [provided by RefSeq

Sequence: RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK

Specifications

• Antigen: BARD1
• Applications: ELISA, Immunofluorescence
• Classification: Monoclonal
• Clone: 2A11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BARD1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BARD1
• Gene Accession No.: NM_000465
• Gene Symbols: BARD1
• Host Species: Mouse
• Immunogen: BARD1 (NP_000456, 658 a.a. ∼ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 580
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ