Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Bardet-Biedl syndrome 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant BBS1.

Manufacturer:  Abnova Corporation H00000582A01

Catalog No. 89-004-031


Add to cart

Description

Description

Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. [provided by RefSeq

Sequence: NQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGL
Specifications

Specifications

Bardet-Biedl syndrome 1
Unconjugated
50% glycerol
NM_024649
BBS2L2|FLJ23590|MGC126183|MGC126184|MGC51114
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
582
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant BBS1.
BBS1
Serum
BBS1
BBS1 (NP_078925, 187 a.a. ~ 295 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit