breast cancer anti-estrogen resistance 3, Mouse, Clone: 3G4, Abnova™

Catalog No.	Quantity
89-014-221	100 μg

Catalog No. 89-014-221 Supplier Abnova Corporation Supplier No. H00008412M01

Description

Mouse monoclonal antibody raised against a partial recombinant BCAR3.

Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. [provided by RefSeq

Sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA

Specifications

• Antigen: breast cancer anti-estrogen resistance 3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BCAR3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BCAR3
• Gene Accession No.: BC039895
• Gene Alias: KIAA0554/NSP2/SH2D3B
• Gene Symbols: BCAR3
• Host Species: Mouse
• Immunogen: BCAR3 (AAH39895, 266 a.a. ∼ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Gene ID (Entrez): 8412
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ