branched chain keto acid dehydrogenase E1, alpha polypeptide, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-032	50 μL

Catalog No. 89-004-032 Supplier Abnova Corporation Supplier No. H00000593A01

Description

Mouse polyclonal antibody raised against a partial recombinant BCKDHA.

The branched-chain alpha-keto acid (BCAA) dehydrogenase (BCKD) complex is an innter mitochondrial enzyme complex that catalyzes the second major step in the catabolism of the branched-chain amino acids leucine, isoleucine, and valine. The BCKD complex consists of three catalytic components: a heterotetrameric (alpha2-beta2) branched-chain alpha-keto acid decarboxylase (E1), a dihydrolipoyl transacylase (E2), and a dihydrolipoamide dehydrogenase (E3). This gene encodes the alpha subunit of the decarboxylase (E1) component. Mutations in this gene result in maple syrup urine disease, type IA. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: SVDEVNYWDKQDHPISRLRHYLLSQGWWDEEQEKAWRKQSRRKVMEAFEQAERKPKPNPNLLFSDVYQEMPAQLRKQQESLARHLQTYGEHYPLDHFDK

Specifications

• Antigen: branched chain keto acid dehydrogenase E1, alpha polypeptide
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BCKDHA.
• Formulation: 50% glycerol
• Gene: BCKDHA
• Gene Accession No.: NM_000709
• Gene Alias: BCKDE1A/FLJ45695/MSU/MSUD1/OVD1A
• Gene Symbols: BCKDHA
• Host Species: Mouse
• Immunogen: BCKDHA (NP_000700, 347 a.a. ∼ 445 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 593
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum