BCL6 co-repressor, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-657	50 μL

Catalog No. 89-004-657 Supplier Abnova Corporation Supplier No. H00054880A01

Description

Mouse polyclonal antibody raised against a partial recombinant BCOR.

The protein encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD

Specifications

• Antigen: BCL6 co-repressor
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant BCOR.
• Formulation: 50% glycerol
• Gene: BCOR
• Gene Accession No.: NM_017745
• Gene Alias: ANOP2/FLJ20285/FLJ38041/KIAA1575/MAA2/MCOPS2/MGC131961/MGC71031
• Gene Symbols: BCOR
• Host Species: Mouse
• Immunogen: BCOR (NP_060215, 1361 a.a. ∼ 1460 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 54880
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum