BCR, Mouse, Clone: 2E5, Abnova™

Catalog No.	Quantity
89-016-297	100 μg

Catalog No. 89-016-297 Supplier Abnova Corporation Supplier No. H00000613M01

Description

Mouse monoclonal antibody raised against a partial recombinant BCR.

A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ

Specifications

• Antigen: BCR
• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 2E5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BCR.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BCR
• Gene Accession No.: NM_004327
• Gene Alias: ALL/BCR-ABL1/BCR1/CML/D22S11/D22S662/FLJ16453/PHL
• Gene Symbols: BCR
• Host Species: Mouse
• Immunogen: BCR (NP_004318.3, 182 a.a. ∼ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 613
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ