Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BDNF (B02P), Mouse anti-Human, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human BDNF protein.

Manufacturer:  Abnova Corporation H00000627B02P

Catalog No. 89-002-539


Add to cart

Description

Description

The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq

Sequence: MFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Specifications

Specifications

BDNF
Unconjugated
In 1X PBS, pH 7.4
NM_170731
MGC34632
Mouse
50 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Immunofluorescence, Western Blot
Mouse polyclonal antibody raised against a full-length human BDNF protein.
BDNF
Purified
BDNF
BDNF (NP_733927.1, 1 a.a. ~ 255 a.a) full-length human protein.
RUO
Primary
627
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit