BIN1, Mouse, Clone: 1H1, Abnova™

Catalog No.	Quantity
89-016-144	100 μg

Catalog No. 89-016-144 Supplier Abnova Corporation Supplier No. H00000274M01

Description

Mouse monoclonal antibody raised against a partial recombinant BIN1.

This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. [provided by RefSeq

Sequence: VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP

Specifications

• Antigen: BIN1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1H1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BIN1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BIN1
• Gene Accession No.: NM_004305
• Gene Alias: AMPH2/AMPHL/DKFZp547F068/MGC10367/SH3P9
• Gene Symbols: BIN1
• Host Species: Mouse
• Immunogen: BIN1 (NP_004296, 355 a.a. ∼ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 274
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ