baculoviral IAP repeat-containing 5, Mouse, Clone: 5B10, Abnova™

Catalog No.	Quantity
89-018-941	100 μg

Catalog No. 89-018-941 Supplier Abnova Corporation Supplier No. H00000332M01

Description

Mouse monoclonal antibody raised against a partial recombinant BIRC5.

This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this gene's expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined. [provided by RefSeq]

Sequence: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGE

Specifications

• Antigen: baculoviral IAP repeat-containing 5
• Applications: ELISA, Immunofluorescence, Immunoprecipitation, KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 5B10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant BIRC5.
• Formulation: PBS with no preservative; pH 7.4
• Gene: BIRC5
• Gene Accession No.: NM_001168
• Gene Alias: API4/EPR-1
• Gene Symbols: BIRC5
• Host Species: Mouse
• Immunogen: BIRC5 (NP_001159, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 332
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ